PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G325400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 316aa    MW: 36075.6 Da    PI: 4.4535
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G325400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.9e-1985138356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ +q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Aqcoe3G325400.1.p  85 KKRRLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWK 138
                        566899***********************************************9 PP

2HD-ZIP_I/II132.91.2e-4284176193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrls +qv++LE+sFe e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkqlEkdy+aLk++yd+lk++ e+L ke+e+L++e++
  Aqcoe3G325400.1.p  84 EKKRRLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDALKASYDSLKSNYENLLKEKEQLKAEVS 175
                        69**************************************************************************************9987 PP

        HD-ZIP_I/II  93 e 93 
                        +
  Aqcoe3G325400.1.p 176 S 176
                        5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-1973142IPR009057Homeodomain-like
PROSITE profilePS5007117.5480140IPR001356Homeobox domain
SMARTSM003893.8E-1983144IPR001356Homeobox domain
CDDcd000862.29E-1785141No hitNo description
PfamPF000462.0E-1685138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1987148IPR009057Homeodomain-like
PRINTSPR000318.8E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000318.8E-6120136IPR000047Helix-turn-helix motif
PfamPF021832.5E-17140180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MASRKVYSAS NVPVLLQNDG ISCSNGAFEA LLMPNSTSCF NGKRSMVNFE DACRGNTQGM  60
SFYHTRDQEE NGDDDLDDCF RQPEKKRRLS VDQVQFLEKS FEVENKLEPE RKVQLAKDLG  120
LQPRQVAIWF QNRRARWKTK QLEKDYDALK ASYDSLKSNY ENLLKEKEQL KAEVSSLTDK  180
QFHKENVSEN SETSKPMEPS QPLAQPDSVP ETKTSTIICK QEDLSSVNSD VFDSDSPHYA  240
DGVHSSFLET GDSSHVFEPD QSDLSQDEED NLSKNLRHVV YNFPKLEDPV YPDQSADCGN  300
YEFPVEDQAL WFWSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242341.11e-139PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A061FXY91e-133A0A061FXY9_THECC; Homeobox protein, putative isoform 1
STRINGVIT_17s0000g05630.t011e-124(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-46homeobox 1